PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna00786.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 546aa    MW: 58846 Da    PI: 6.7604
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna00786.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.12e-081255445
                             S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                             WT e d+ + +a + ++ +   +W++Ia+ +  g + +++k+++ 
  mrna00786.1-v1.0-hybrid 12 WTWEQDKAFENALATYPEDspdRWEKIAADVE-GISVEEIKHHYE 55
                             ********************************.**********95 PP

2Myb_DNA-binding26.61.4e-082112481047
                              HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              e+++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
  mrna00786.1-v1.0-hybrid 211 EQFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 248
                              789999*******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.7E-6860IPR001005SANT/Myb domain
SuperFamilySSF466897.4E-101065IPR009057Homeodomain-like
CDDcd001672.23E-61258No hitNo description
PfamPF002491.3E-61255IPR001005SANT/Myb domain
SMARTSM007170.11201251IPR001005SANT/Myb domain
CDDcd001671.18E-5210249No hitNo description
Gene3DG3DSA:1.10.10.605.5E-6211247IPR009057Homeodomain-like
SuperFamilySSF466898.97E-10211254IPR009057Homeodomain-like
PfamPF002492.1E-6211248IPR001005SANT/Myb domain
TIGRFAMsTIGR015576.5E-11212251IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MSVEEAAASS LWTWEQDKAF ENALATYPED SPDRWEKIAA DVEGISVEEI KHHYELLVDD  60
ISQIEAGCIP LPCYNSSSDG STSLANDEGT SKKGHYGSES NHGSKASRAD QERRKGVAWT  120
EDEHSGVPLL RDYEFACPVI TKVAFADSAG REGKMNFLFM NVPFSILDIF IPQDLLFSDG  180
LPVSLASAIA PHHNCINIKE NGDSSVGIGI EQFLLGLEKY GKGDWRSISR NFVVTRTPTQ  240
VASHAQKYFI RLNSMNKDRR RSSIHDITSV DNGEVATIQG PITGQSNGPA VGLSGSGKSA  300
KQSAAGPPGV GMYGAPSIGQ PIGGPLVSAV GTPVNLVGPS PHMAYGVRAP MPPGALVPGA  360
PMNMPPMTYP MPHTAHSHWV ESDTQRRETG KNYNDMNMYR PIAKGMVTAA ATAHRHLNSE  420
SVKIKASRQT SENTSSLWSV SEIARAVNGR IAKWVRLRGV IGNRVWHNWE KGFVQNSDGL  480
FYSPACKQLV GVTGSVVETG TMSMIALALQ SSKKPVYQSH GNRNNRIDGD GDEWQGRAIG  540
ACEDG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1712771176RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285590.0FR828559.1 Rosa hybrid cultivar mRNA for putative MYB transcription factor (myb8 gene), cultivar Yellow Island.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579878.11e-122PREDICTED: transcription factor DIVARICATA-like isoform X1
TrEMBLF2QKX91e-105F2QKX9_R
STRINGGLYMA07G28310.12e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46943358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.16e-58MYB family protein